PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1516_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 800aa    MW: 87524.1 Da    PI: 6.9938
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1516_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095806171954
                                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                          Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  cra_locus_1516_iso_5_len_3094_ver_3 580 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 617
                                          664459******************************88 PP

2BELL120.86e-39442512272
                                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                          r e+q++k+kLl++l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdaia q+
  cra_locus_1516_iso_5_len_3094_ver_3 442 RLEHQRRKVKLLTMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAIPYTALAQKAMSRHFRCLKDAIAAQL 512
                                          779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-78362510IPR006563POX domain
PfamPF075262.7E-52367509IPR006563POX domain
PROSITE profilePS5007112.568558621IPR001356Homeobox domain
CDDcd000861.16E-12561622No hitNo description
SMARTSM003892.0E-9561625IPR001356Homeobox domain
SuperFamilySSF466895.99E-17563628IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28564627IPR009057Homeodomain-like
PfamPF059204.1E-18578617IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MGIATTHLLL PCHSKQQILV SNSDKSLLIN SMSEDYHNHH HQGFFSNFSN GFERSQQQQQ  60
HLQQHQHHMS QQIRRDKLRI QGFHEQQQPP PPHPPPPPLD AIEEVVESTG LNPVYETAGM  120
LSEMFNFTST AAGDISNLEN NYRNSRPPPP ATAESQWYGN NRQLGLMMGG NLGPLDETKN  180
QDIGNHDRDS TTTIATSTTH HHHRHQHHHP QQISGNINAD SASAAAAAMH LFLMNPQPRS  240
PSPPPPAASS STLHMLLPNQ GFHPHPPQFH LDASEIGGGG GGGIVEGQGL SLSLSSSLQH  300
LEKAEELRMG GDGHGMIFFN QGGGGGGTST PGAQYPNYKN MGAPLHLQSP NNQVHVGYGS  360
SIGMVNVLRN SKYAKAAQEL LEEFCSVGRG HLKKNKLLPK NNNNNPNPNS SNQCGGGNGG  420
GGNGGNSSSS SKDLPPLSAS DRLEHQRRKV KLLTMLDEVD RRYNHYCEQM QMVVNSFDLV  480
MGFGAAIPYT ALAQKAMSRH FRCLKDAIAA QLKQSCEMLG EKDAGTSGVT KGETPRLRLL  540
EQSLRQQRAF HQMGMMEQEA WRPQRGLPER SVNILRAWLF EHFLHPYPSD ADKHLLARQT  600
GLSRNQVSNW FINARVRLWK PMVEDMYQQE AKEEEEAAEA DDQEEETTIT QTTDSTTNII  660
TQTPTPTNTA TANTAAITSS STRSKRSEIN DSENDPSLIA INTHCSFPEN QAKSSTSSLI  720
LPNTTTTTLP PQAYQYSAEA FRRGGGVGVI SGNPAEIGAS HHLVRFGTNA GDVSLTLGLR  780
HAGNLPQEKS TFSVRDFGGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16567624158Homeobox protein Meis1
4xrs_B2e-16567624158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425771.10.0hypothetical protein CICLE_v10024897mg
RefseqXP_006466698.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-168BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLV4SPH40.0V4SPH4_9R
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
STRINGVIT_04s0023g01020.t010.0(Vitis vinifera)